PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2728_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 258aa    MW: 29071.8 Da    PI: 4.765
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2728_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.3e-373391361
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                e+a +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rk+ +s
  RrC2728_p1 33 ETAPPCPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVGGGCRKRSRS 91
                56678**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-253385IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5283690IPR003851Zinc finger, Dof-type
PfamPF027011.0E-313690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MLPYNAHNSY QHQFPSQEIE IPAKWKISYG HEETAPPCPR CASSNTKFCY YNNYSLSQPR  60
YFCKGCRRYW TKGGSLRNIP VGGGCRKRSR SRRQSSHKRF GPSENQPDVL MNGSQSSHAG  120
SDIDLAAVFA QYVNAPSPSS TDNTTGSDQD SPVVTTTNTH ALDSLSWDIC QETDANLGFY  180
GEFNDLTNKI QEDERGLGQF LQEDQEEIFE FQGLLNDKDI QEILECSFSE EPDQLTSQGS  240
FMINGDHWSS TDLTRFGI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18691KRSRSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103298.11e-162PREDICTED: dof zinc finger protein DOF1.2-like
SwissprotP683491e-153DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLM4D7171e-162M4D717_BRARP; Uncharacterized protein
STRINGBra012277.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.11e-143Dof family protein